DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and RACGAP1

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_024304726.1 Gene:RACGAP1 / 29127 HGNCID:9804 Length:651 Species:Homo sapiens


Alignment Length:270 Identity:111/270 - (41%)
Similarity:155/270 - (57%) Gaps:14/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QSHSGLLREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQI 142
            ||:.| :|.|:|..|: .....:||.|.|||:|...||:||.|.:..|..|..:..:.||| ..|
Human   298 QSNGG-MRLHDFVSKT-VIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIP-TLI 359

  Fly   143 GTK----RGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKS 203
            ||.    .|.|:|:..:.:||:|:::||||.|||.|||.:.||||:|......|.|:.|.||.|:
Human   360 GTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKT 424

  Fly   204 TPHLGN-KDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHR 267
            .|.|.. .|.|.:|..:|||||.|..||:.....|.|.||....|......|:|.||.||.||:|
Human   425 VPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANR 489

  Fly   268 DTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPTLFG------DLDLTLENVVTWQRVLKVLLLMP 326
            ||||:||:|.|::|:||..:|.|.|||.:|.||:..      |....|:::....:|::.||.:|
Human   490 DTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLP 554

  Fly   327 AGFWSQFLEV 336
            ..:||||:.|
Human   555 LEYWSQFMMV 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 19/51 (37%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 82/198 (41%)
RACGAP1XP_024304726.1 SMC_N 32..>124 CDD:330553
C1 306..354 CDD:237996 17/48 (35%)
RhoGAP_MgcRacGAP 365..558 CDD:239847 79/192 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4660
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S4674
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4412
SonicParanoid 1 1.000 - - X3396
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.