DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr98d

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster


Alignment Length:409 Identity:75/409 - (18%)
Similarity:138/409 - (33%) Gaps:150/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FYRYGHVYALIYGQVVID-------YVPQR---------ALKRGVKVLLIAYGHLFSMLLIVVLP 66
            |.|...:|..| ..:.||       :|.||         ||..|:.::|:.  .|.....:|.|.
  Fly   108 FRRLARIYDDI-ADLEIDLNNASSGFVGQRHWWRFRFRLALSVGLWIVLLV--GLTPRFTLVALG 169

  Fly    67 GYFCYHFRTLTDTLDRRLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFE- 130
            .|..:..:.||:.:...|||        ...:|...::     .::...:..|..:|:..:|.| 
  Fly   170 PYLHWTNKVLTEIILIMLQL--------KCTEYCVFVL-----LIYELILRGRHILQQISVELEG 221

  Fly   131 --FKNAPQEPKRPFEFFMYFKFCLI---NLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVL 190
              .:::.||            .|:.   |.::..::.|:           |::|.::|.:...:|
  Fly   222 NQSRDSVQE------------LCVALKRNQLLAGRIWGL-----------VNEVSLYFTLSLTLL 263

  Fly   191 WNYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGMLLHHCCELSDRLEELRRRCRE 255
            :.|.|  ......:|.:::|                 .:.|     :.||               
  Fly   264 FLYNE--LTILQIVNWALIK-----------------SVNP-----NECC--------------- 289

  Fly   256 IHDLQRESFRMHQFQLIGLMLSTLIN-NLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDT 319
                        |::.:|..|...|| .|:..|:.|.:....|:..|.:.:...|.      .:.
  Fly   290 ------------QYRRVGTCLLLSINIFLSCLYSEFCIQTYNSISRVLHQMYCLSA------AED 336

  Fly   320 YIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIEHLSLELLNYQPPMLC-GLLHLDRRLV 383
            |::      :|:.|...:|.|                 |||.|       ...| ||..::.:..
  Fly   337 YLI------LKMGLREYSLQM-----------------EHLKL-------IFTCGGLFDINLKFF 371

  Fly   384 YLIAVTAFSYFITLVQFDL 402
            ..:.||.|.|.|.||||.:
  Fly   372 GGMVVTLFGYIIILVQFKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 74/405 (18%)
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 75/409 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.