DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr68a

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:392 Identity:75/392 - (19%)
Similarity:148/392 - (37%) Gaps:100/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YGHLFSMLLIV--------VLPGYFCYHFRTL------TDTLDRRLQLLFYVSFTNTAIKYATVI 103
            ||.|.::::::        ||  :....:|.:      |:.::|.::.|..:      |.|..|:
  Fly    40 YGRLVALIILIGSLTLGEDVL--FASKEYRLVASAQGDTEEINRTIETLLCI------ISYTMVV 96

  Fly   104 VTYVAN-TVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVC--GIF 165
            ::.|.| :.||..::....:.    |:...|..:|           .:...||.:::...  |:.
  Fly    97 LSSVQNASRHFRTLHDIAKID----EYLLANGFRE-----------TYSCRNLTILVTSAAGGVL 146

  Fly   166 A--------QYGEVGKGSVSQVRVHF--AIYAFVLWNYTE----NMADYCYFINGSVLKYYRQFN 216
            |        :.|...|..:..:.::|  .:|:.:|..|..    |:|....|:|..:    ..||
  Fly   147 AVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKL----DTFN 207

  Fly   217 LQLGSLRD--EMDGLRPGGMLLHHCCELSDRLEEL---RRRCREIHDLQRESFRMHQFQLIGLML 276
            ||     |  .|:..|          |||:.:|.|   |.....|:.:...|...:    .|...
  Fly   208 LQ-----DCGHMENWR----------ELSNLIEVLCKFRYITENINCVAGVSLLFY----FGFSF 253

  Fly   277 STLINNLTNFYTLFHMLAKQSLE---EVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVAL 338
            .|:.|   ..|..|..|...||.   ||:..:.:..::.....|...::....:.:..|:...|.
  Fly   254 YTVTN---QSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQ 315

  Fly   339 TMRR-FAEPRE----MDERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLV 398
            .:.| :.:.::    :|:.||:.|:. .|:...|      |...:|...::.|.....:|.:.|:
  Fly   316 ILARIYGKSKQFQNLIDKFLTKSIKQ-DLQFTAY------GFFSIDNSTLFKIFSAVTTYLVILI 373

  Fly   399 QF 400
            ||
  Fly   374 QF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 75/392 (19%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 75/392 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.