DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr33a

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:474 Identity:87/474 - (18%)
Similarity:143/474 - (30%) Gaps:193/474 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SFTNTAIKYATVIVT---YVA-----NTVH------FEAINQRCTMQRTHLEFEFKNA------- 134
            |.||..:.||.:.:.   |||     |..|      .::.|..|.:. :|| |....|       
  Fly    22 SETNFILDYAMMCIVPIFYVACYLLINLSHIIGLCLLDSCNSVCKLS-SHL-FMHLGAFLYLTIT 84

  Fly   135 PQEPKRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMAD 199
            .....|..|||..|...|.::..:||.|   .:..|:.|..|:.|: |...|.|. |.:.     
  Fly    85 LLSLYRRKEFFQQFDARLNDIDAVIQKC---QRVAEMDKVKVTAVK-HSVAYHFT-WLFL----- 139

  Fly   200 YCYFINGSVLKYY--RQFNLQLGSLR---------DEMDGLRPGGMLLHHCCELSDR-------L 246
            :|.|   :...||  |...|..|:|.         ..:.|....|..::|...:|.|       |
  Fly   140 FCVF---TFALYYDVRSLYLTFGNLAFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQINMLL 201

  Fly   247 EELRRRCREIH------DLQRES------------------------------------------ 263
            |::.:..|..|      |::.|.                                          
  Fly   202 EKINQEARHRHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKNDD 266

  Fly   264 ------------------------------------FRMHQ------------------------ 268
                                                |::|.                        
  Fly   267 DDLDTSNDEDEDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAAC 331

  Fly   269 --FQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALI------ 325
              ..:.|:.|.|.:|.:...       ..:.|:.::|..|:.|       ..|.:||.|      
  Fly   332 FVVSIFGIFLETKVNFIVGG-------KSRLLDYMTYLYVIWS-------FTTMMVAYIVLRLCC 382

  Fly   326 --NEHIKLELEAVALTMRRFAEPREM--DERLTREIEHLSLELLNYQPPML---CGLLHLDRRLV 383
              |.|.|.....|...|::  :|..|  ::....:::..:|:.|:::....   .||..||...:
  Fly   383 NANNHSKQSAMIVHEIMQK--KPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFI 445

  Fly   384 YLIAVTAFSYFITLVQFDL 402
            :.....|.||.|.|:|||:
  Fly   446 FSTVSAATSYLIVLLQFDM 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 86/472 (18%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 35/192 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.