DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr32a

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:405 Identity:81/405 - (20%)
Similarity:147/405 - (36%) Gaps:103/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQLLFYVSFTNTAIKYATVIVTYVA 108
            |||...|..: :::|:...:....:|.|.   .||.:::.::||.             .|:||..
  Fly    96 RGVVHALTIF-NVYSLFTPISAQLFFSYR---ETDNVNQWIELLL-------------CILTYTL 143

  Fly   109 NTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPF--EFFMYFKFCLINLMMMIQVC-------GI 164
             ||...|.|   |.....:..|.....:|.:|.|  .....|.| |:..::.|..|       .|
  Fly   144 -TVFVCAHN---TTSMLRIMNEILQLDEEVRRQFGANLSQNFGF-LVKFLVGITACQAYIIVLKI 203

  Fly   165 FAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVL------------------KY 211
            :|..||:...|          |..:.:...:|.....|.:..|.|                  .|
  Fly   204 YAVQGEITPTS----------YILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTY 258

  Fly   212 YRQFNLQLGSLR------DEMDGLRPGGMLLHHCCE-------LSDRLEELRRRCREIHDLQRES 263
            .:|...:.|..|      |....:.|.  |:.|..|       :.::|..:.:...:..:|...|
  Fly   259 GQQHRRKEGGARARRQRGDVNPNVNPA--LMEHFPEDSLFIYRMHNKLLRIYKGINDCCNLILVS 321

  Fly   264 FRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALINEH 328
            |..:.|..:          .||.|.||..:..:.:  || |.::...:| ...:...::||::..
  Fly   322 FLGYSFYTV----------TTNCYNLFVQITGKGM--VS-PNILQWCFA-WLCLHVSLLALLSRS 372

  Fly   329 IKL---ELEAVALTMRR-FAEPRE----MDERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYL 385
            ..|   |..|.:..:.| :|:.:|    :|:.||:.|:. .::...|      |...:|...::.
  Fly   373 CGLTTTEANATSQILARVYAKSKEYQNIIDKFLTKSIKQ-EVQFTAY------GFFAIDNSTLFK 430

  Fly   386 IAVTAFSYFITLVQF 400
            |.....:|.:.|:||
  Fly   431 IFSAVTTYLVILIQF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 81/405 (20%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 81/405 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.