DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr23a

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:269 Identity:52/269 - (19%)
Similarity:101/269 - (37%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YHFRTLTDTLDRRLQLLFY---VSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFK 132
            ||.:||...|..::|::.:   |...|..::...:.:..:|     ..::.|...::...:|..:
  Fly   146 YHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQLLILA-----RELSCRWPQRKQKPQFSDQ 205

  Fly   133 NA--PQEPKRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFA----------- 184
            .|  .::.||.:....|         :.:::.|.|      |...::.:.||||           
  Fly   206 QAHRVKDLKRRYNDLHY---------LFVRINGYF------GGSLLTIIIVHFAIFVSNSYWLFV 255

  Fly   185 --------IYAFVL-----WNYTENMADYCYFINGSVLKYYRQFNL--QLGSLRDEMDGLRPGGM 234
                    |||.:|     :|....||..|:....|       :||  |:|.|..::  ::|.|.
  Fly   256 DIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQS-------YNLGRQIGCLISKL--VKPQGS 311

  Fly   235 LLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTL-FHMLAKQSL 298
            .|:     :|.:.|.        .||    .:||         ..:....:|::| .|:|:....
  Fly   312 KLY-----NDLVSEF--------SLQ----TLHQ---------RFVVTAKDFFSLNLHLLSSMFA 350

  Fly   299 EEVSYPVVV 307
            ..|:|.|::
  Fly   351 AVVTYLVIL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 52/269 (19%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 52/269 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.