DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr21a

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:454 Identity:81/454 - (17%)
Similarity:130/454 - (28%) Gaps:205/454 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPDER----------------------------------KSFWERHEFKFYR-------YGHV 24
            :||||:|                                  |:.|..:::||::       :.::
  Fly   136 VTSPDKRFDEAIYNVIFISLLFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNL 200

  Fly    25 YALIYGQVVIDYVPQRALKRGVKVL--------LIAYGHLFSMLLIVVLPGYF-CYHFRTLTDTL 80
            |.|.:...|..::...|:......|        ..||..:.:||.......|. |..|.|.:..|
  Fly   201 YPLTWSLCVFSWLLSIAINLSQYFLQPDFRLWYTFAYYPIIAMLNCFCSLWYINCNAFGTASRAL 265

  Fly    81 DRRLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFF 145
            ...||                       .|:..|...|:.|..| ||..:..:..|:..|.:. .
  Fly   266 SDALQ-----------------------TTIRGEKPAQKLTEYR-HLWVDLSHMMQQLGRAYS-N 305

  Fly   146 MYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVLK 210
            ||..:||:     |....|.|.|     ||:|::..|.|.|..|                     
  Fly   306 MYGMYCLV-----IFFTTIIATY-----GSISEIIDHGATYKEV--------------------- 339

  Fly   211 YYRQFNLQLGSLRDEMDGLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLM 275
                             ||   .:::.:|..|      |...|.|.|...|:         :||.
  Fly   340 -----------------GL---FVIVFYCMGL------LYIICNEAHYASRK---------VGLD 369

  Fly   276 LSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTM 340
            ..|.:.|                                                :.|.||    
  Fly   370 FQTKLLN------------------------------------------------INLTAV---- 382

  Fly   341 RRFAEPREMDERLTREIEHLSLELLNYQPPM--LCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402
                     |....:|:|.| |..:|..||:  |.|..:::|.|:........:|.:.|:||.:
  Fly   383 ---------DAATQKEVEML-LVAINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 72/399 (18%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 81/454 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.