DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and lite-1

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:262 Identity:49/262 - (18%)
Similarity:92/262 - (35%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 AIYAFVLWNY-----------TEN-----MADYCYFINGSVLK-----YYRQFNLQLGSLRDEMD 227
            |.||...|.|           ||.     :..|..|::.:.:.     :|:..::...|::..::
 Worm   184 ATYAMSKWGYILYIVGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSVIRRSIKHLIN 248

  Fly   228 GLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYT---- 288
            .:.|..   ...|.|.:      ...::|||.|....|:..    |..:.....:...||:    
 Worm   249 EMVPAE---QDECPLPE------SSLQKIHDCQISYQRIFN----GKAVIEEYYSFVLFYSYGVC 300

  Fly   289 ----LFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVAL--------INEH-IKLELEAVALTM 340
                .|.|....|.:.:.:..||..|.   :.::..:|.|        |||. .:|...:..:..
 Worm   301 IPIFCFLMFVGMSAQSICWSEVVSIVI---WIVNAILVLLLFSLPAFMINEDGDRLVASSFRMYH 362

  Fly   341 RRFAEPREMD-----ERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQF 400
            ..|.|.|::.     ...|.:|....|.|      ..|...::||.::..:.....:||:.|.:|
 Worm   363 ETFHEERDLTVLSQMTFFTFQIHSTKLTL------SACNYFYMDRSILLSLFSAILTYFLILWEF 421

  Fly   401 DL 402
            |:
 Worm   422 DI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 48/260 (18%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 49/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.