DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr28b

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:447 Identity:80/447 - (17%)
Similarity:146/447 - (32%) Gaps:176/447 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FYR-----YGHVYALIYGQVVID------YVPQRALKR---------------GV-----KVLLI 51
            |:|     :|.:..::.|.:.:.      :||...|:|               ||     |||..
  Fly   109 FFRSRITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYSKVLRF 173

  Fly    52 AYGHLFSMLLIVVL--PGYF------------CYHFRTLTDTLDRRLQLLFYVSFTNTAIKYATV 102
            :|..|.||.|:.||  .|.|            ..||..|.......:.:..:..||........:
  Fly   174 SYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIALFSCFTYLVEMRLVM 238

  Fly   103 IVTYVANTVH------FEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQV 161
            :...:.|..|      .:|:||:   ||: |:                      ||.:       
  Fly   239 VNKVLKNLAHQWDTRSLKAVNQK---QRS-LQ----------------------CLDS------- 270

  Fly   162 CGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEM 226
                                 |::|..|    |::.|:.                     :::.|
  Fly   271 ---------------------FSMYTIV----TKDPAEI---------------------IQESM 289

  Fly   227 DGLRPGGMLLHH-CCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLM-LSTLINNLTNFYTL 289
            :        :|| .||.:                 ..:.:...:||:.:: ::.||.....:|.|
  Fly   290 E--------IHHLICEAA-----------------ATANKYFTYQLLTIISIAFLIIVFDAYYVL 329

  Fly   290 FHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALI------NEHIKLE-----LEAVALTMRRF 343
            ..:|.|...|.....|...:.::....:  |::|:|      |..||..     :....|...:.
  Fly   330 ETLLGKSKRESKFKTVEFVTFFSCQMIL--YLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKS 392

  Fly   344 AEPREMDERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQF 400
            ||.:|..::.:.::.||.:..      ...||.::||.|.:.|:....:|.|.|:||
  Fly   393 AEVKEKLQQFSMQLMHLKINF------TAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 79/445 (18%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 78/445 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.