DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr59b

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:432 Identity:83/432 - (19%)
Similarity:150/432 - (34%) Gaps:134/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFYR--YGHVYALIYGQVVIDYVP----QRAL-----KRGVKVLLIAYGHLFSMLLIVVLPGYFC 70
            ||:.  :...||||...|.:..:|    |..|     |...|::||......::..:|:|.....
  Fly    27 KFFSTLFSRTYALIANIVTLIMLPIVMWQVQLVFQQKKTFPKLILITNNVREAVSFLVILYTVLS 91

  Fly    71 YHFRTLTDTLDRRLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAP 135
            ..||   ||..:.:|.|....|..                      .:||         .||.. 
  Fly    92 RGFR---DTAFKEMQPLLLTLFRE----------------------EKRC---------GFKGI- 121

  Fly   136 QEPKRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADY 200
            ...:|.....::.||..::.:.:..|.                    |.:|:          .|.
  Fly   122 GGVRRSLRILLFVKFFTLSWLCVTDVL--------------------FLLYS----------TDA 156

  Fly   201 CYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGG--MLLHHCCELSDRLEELRRRCREIHDLQRES 263
            ..::|  ||:::  |.....::.:    :.|.|  :.|.|   ::...:.:.||..:|  ::.:|
  Fly   157 LIWVN--VLRFF--FKCNTNNILE----MVPMGYFLALWH---IARGFDCVNRRLDQI--VKSKS 208

  Fly   264 FRMH-QFQLIGLMLSTLINNLTNFYTLF--HMLAKQ-------------------SLEEVSYPVV 306
            .|.| :.|.:.|:.:.|.....|...::  .|||.:                   .|....:.||
  Fly   209 TRKHRELQHLWLLHACLTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAVFTFDLSTPFFWVV 273

  Fly   307 VGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREI-------EHLSLEL 364
            .|||......:|.|::..:.:        ||:.....|:....:.|.|:||       ....|:|
  Fly   274 YGSVQYHVRCLDYYLIDNMCD--------VAVEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQL 330

  Fly   365 LNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDLYLRK 406
            .:      |||...:|.:.:.:..:...|.:.|:||.|.:||
  Fly   331 WS------CGLFQANRSMWFAMISSVLYYILVLLQFHLVMRK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 78/423 (18%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 81/428 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.