DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr93b

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:433 Identity:97/433 - (22%)
Similarity:138/433 - (31%) Gaps:164/433 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YGHVYALIYGQVVIDYVPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTD---TLDR 82
            ||:.|....||....|:  ||. .|.:::    |.|...::|:|:..:|......|.:   .|.|
  Fly    71 YGYSYDAWSGQYEDMYL--RAF-FGFRLI----GCLICSVIILVMQFWFGEELINLVNRFLQLFR 128

  Fly    83 RLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPF----E 143
            |:|     |.||:                                          ||..|    |
  Fly   129 RMQ-----SLTNS------------------------------------------PKNRFGDRAE 146

  Fly   144 F-------------FMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAF----VLW 191
            |             ||.|:..|....::..||.:   |..||.|.::    |.....:    ||:
  Fly   147 FLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDL---YTSVGTGMIT----HLCFVGYLSIGVLY 204

  Fly   192 NYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGM-------LLHHCCELSDRLEEL 249
            ....|..| |            |...||.||..|.:..|....       .|..|..|.|     
  Fly   205 RDLNNYVD-C------------QLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYD----- 251

  Fly   250 RRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATG 314
                 |||.:.| ||:    ||..|.|         |.:|...|...|:  |||..::...|:..
  Fly   252 -----EIHQVSR-SFQ----QLFDLPL---------FLSLAQSLLAMSM--VSYHAILRRQYSFN 295

  Fly   315 FYIDTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIE------------HLSLEL--- 364
            .:      .|:   |||.::.|.|||.  ........||.|.:.            |..|||   
  Fly   296 LW------GLV---IKLLIDVVLLTMS--VHSAVNGSRLIRRLSFENFYVTDSQSYHQKLELFLG 349

  Fly   365 -LNYQP----PMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402
             |.:|.    |:  ||..:...|.........:|.:.|||:.:
  Fly   350 RLQHQELRVFPL--GLFEVSNELTLFFLSAMVTYLVFLVQYGM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 97/431 (23%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 97/433 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.