DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr22f

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:432 Identity:86/432 - (19%)
Similarity:161/432 - (37%) Gaps:97/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSFWERHEFKFY-RYGHVYALIYGQVVIDYVP------QRALKRGVKVLLIAYGH-LFSMLLIVV 64
            |.|..|..|..: .:..:...:|...::...|      ::.|||...:||  ||. |.|:.:.:.
  Fly     2 KMFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLL--YGFVLHSLAMCLA 64

  Fly    65 LPGYFCYHFRTLTDTLDRR-LQLLFYVSFTNTAIKYATVIV---TYVANTVHFEAINQRCTMQRT 125
            :..:.....|...:..:|. |....|:.|..|.....:|::   .:.:|||. :..|:..|::..
  Fly    65 MSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVR-KIANELLTLEGQ 128

  Fly   126 HLE-FEFKNAPQEPKRPFEFFMYFK-------------FCLINLMMMIQVCGIFAQYGEVGKGSV 176
            ..: ...||.|.     |..|:..|             |||.......::..|......||   :
  Fly   129 VKDLLTLKNCPN-----FNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVG---L 185

  Fly   177 SQVRVHF-----AIYAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGMLL 236
            ..:.:||     .:|.:| |...|.:.|                :..|.|.|            :
  Fly   186 QLIIMHFHTEIILVYRYV-WLVNETLED----------------SHHLSSSR------------I 221

  Fly   237 HHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHM---LAKQSL 298
            |....|.|||.:|.......:||          |||.:::..||.|....:.|..:   :.|:.:
  Fly   222 HALASLYDRLLKLSELVVACNDL----------QLILMLIIYLIGNTVQIFFLIVLGVSMNKRYI 276

  Fly   299 EEVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIEHLSL- 362
            ..|:.|.::.:.:  .|:::..:..|..:.    .:..:..::.|.:....||.|.|.:...:. 
  Fly   277 YLVASPQLIINFW--DFWLNIVVCDLAGKC----GDQTSKVLKLFTDLEHDDEELERSLNEFAWL 335

  Fly   363 ---ELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQFD 401
               ....:|   ||||..::..:.:.:.:|:|.|.:.|:|||
  Fly   336 CTHRKFRFQ---LCGLFSINHNMGFQMIITSFLYLVYLLQFD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 82/419 (20%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 82/415 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.