DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr10a and Gr98b

DIOPT Version :9

Sequence 1:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:425 Identity:92/425 - (21%)
Similarity:142/425 - (33%) Gaps:128/425 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQ---LLFYVSFTNTAIKYATVIVTY-------- 106
            |..:||:..:...|..|.:       |..|||:   :..|| |..|||.....||:|        
  Fly    15 YLDIFSVFALTPPPQSFGH-------TPHRRLRWYLMTGYV-FYATAILATVFIVSYFNIIAIDE 71

  Fly   107 --------------------------VANTVHFEAINQR----CTMQRTHLEFEFKNAPQ---EP 138
                                      :||.::. .||.|    .......||.:...|.|   ..
  Fly    72 EVLEYNVSDFTRVMGNIQKSLYSIMAIANHLNM-LINYRRLGGIYKDIADLEMDMDEASQCFGGQ 135

  Fly   139 KRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYF 203
            ::.|.|  .|:..|...:.||.:.|...:......|......:.. :..||:........:||.|
  Fly   136 RQRFSF--RFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKI-LTEFVMIMQQLKSLEYCVF 197

  Fly   204 INGSVLKYYRQFNLQ--LGSLRDEMDGLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRM 266
            :   ::.|.....|:  |..|::|...           ||..|.|:.|   |..   |:|....:
  Fly   198 V---LIIYELVLRLRRTLSQLQEEFQD-----------CEQQDMLQAL---CVA---LKRNQLLL 242

  Fly   267 HQ-FQLIG---------LMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDT-- 319
            .: ::|.|         ::|..|.|.|    |:.||              |...|...|..|:  
  Fly   243 GRIWRLEGDVGSYFTPTMLLLFLYNGL----TILHM--------------VNWAYINKFLYDSCC 289

  Fly   320 -YIVALINEHIKLELEAVALTMRRFAE-----PREMDE-----------RLTREIEHLSLELLNY 367
             |...|:...:.:.|....|..:|...     ||.:.:           .|||.:...||::.:.
  Fly   290 QYERFLVCSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNFAMLTRGLREYSLQMEHL 354

  Fly   368 QPPMLCGLLHLDRRLVYL--IAVTAFSYFITLVQF 400
            :....||.| .|..|.|.  :.||.|.|.|.|:||
  Fly   355 KLRFTCGGL-FDINLKYFGGLLVTIFGYIIILIQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 92/425 (22%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 92/425 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.