DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr63a

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:348 Identity:68/348 - (19%)
Similarity:111/348 - (31%) Gaps:143/348 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LVLYFG-IPNSKIVVY--------EAVCIYIVQLEVLMVVMHFHLAVIYIYRYLWIINGQLLDMA 215
            |..|.| :.|::|.:.        |||..|:..:.:|.::         |...||....::..:.
  Fly   119 LACYVGYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIM---------IIPILWYEARKIAKLF 174

  Fly   216 SRLRRGDSVDPDRIQLLLWLYS-RLLDLNHRLTAIY---------DIQVTLFMATLFSVNI---- 266
            :        |.|..::|.:..| ..|.|..|..|:|         .:.|.:...|:..:||    
  Fly   175 N--------DWDDFEVLYYQISGHSLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVV 231

  Fly   267 ------------------------IVGHVLV--------------------ICWINITR------ 281
                                    |..|:|.                    :.|:.:::      
  Fly   232 PYCILDNLTAMLGAWWFLICEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTG 296

  Fly   282 ------FSLLVIFLLFPQALII------------------NFWDLWQ-GIAF--CDLAE--STGK 317
                  |..:.::|.|...|.|                  ....||. |:.|  ||.|.  |...
  Fly   297 NALCYTFVFMSLYLFFIITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAHYASVNV 361

  Fly   318 KTSMILKL----FNDMENMDQETE----RRVTEF---TLFCSHRRLKVCHLGLLDINYEMGFRMI 371
            :|:...||    .|.| |.|.:||    .|.||.   |:.|.         |..|:|..:...::
  Fly   362 RTNFQKKLLMVELNWM-NSDAQTEINMFLRATEMNPSTINCG---------GFFDVNRTLFKGLL 416

  Fly   372 ITNILYVVFLVQFDYMNLKFKTD 394
            .|.:.|:|.|:||   .:...||
  Fly   417 TTMVTYLVVLLQF---QISIPTD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 66/340 (19%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 66/343 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.