DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr59f

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:414 Identity:80/414 - (19%)
Similarity:167/414 - (40%) Gaps:111/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TLYGSWVL------GLFPFTF----DSRKRRLNRSKW-LLAYGL-VLNL---TLLVLSMLPSTDD 71
            ||:  |:|      ...|.|.    .:|..||....| :|.||| ||..   .:||.:...|.|.
  Fly    36 TLF--WLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLFVLGSYWEFVLVTTQRVSLDR 98

  Fly    72 H-NSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLML 135
            : |:::..::           :|.:.|::      |.|:...:...:::..::..|.|   :...
  Fly    99 YLNAIESAIY-----------VVHIFSIM------LLTWQCRNWAPKLMTNIVTSDLN---RAYT 143

  Fly   136 SECHTFNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVCIYIVQLEVLMVVMHFHLAVIYI 200
            .:|:...|::  :..:.::.|.:.|.::|.|...|.|||.::      |.:...||...::.|..
  Fly   144 IDCNRTKRFI--RLQLFLVGIFACLAIFFNIWTHKFVVYRSI------LSINSYVMPNIISSISF 200

  Fly   201 YRYLWIINGQLLDMASRLRR-GDSVDPD----------RIQLLLWLYSRLLDLNHRLTAIYDIQV 254
            .:|..::.|    :|.|.|| .:.::.:          .:|.:...::.|:|....:...:...:
  Fly   201 AQYYLLLQG----IAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSI 261

  Fly   255 TLFMATLFSVNIIVGHVLVICWINITRFSLLVIFLLF-----PQALIINFWD---LWQGIAFCDL 311
            .|         :.||     |::|..    ||:||::     |.......|.   ||       |
  Fly   262 LL---------LFVG-----CFLNFN----LVLFLVYQGIENPSMADFTKWVCMLLW-------L 301

  Fly   312 AESTGKKTSMI-------------LKLFNDMENMDQETERRVTEF--TLFCSHRRLKVCHLGLLD 361
            |...||..|::             |.|.:.:....::.:..:|.|  .:..:.|:..||  |:::
  Fly   302 AMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVC--GVIN 364

  Fly   362 INYEMGFRMIITNILYVVFLVQFD 385
            ::.:....:::.:..:.:||:|:|
  Fly   365 LDLKFLTTLLVASADFFIFLLQYD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 80/414 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 73/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.