DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr9a

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:336 Identity:63/336 - (18%)
Similarity:123/336 - (36%) Gaps:86/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLM--------LSECHTFNRYVIEKGLV 151
            :|.|:..:.|:....:..:|.|......:::..|...|::        |.||..| ||::|:   
  Fly    40 LIELVGEIETYFTEENPDNESVPAYFAKVIMGVNMAYKMIHAWIALSALFECRRF-RYLLEE--- 100

  Fly   152 IILEIGSSLVLYFGIPNSKIV--VYEAVCIYIV--QLEVLMVVMHFHLAVIYI----YRY-LWII 207
                          :|..|..  :|..:.:.|:  .....:|:..:.:..||:    |.| |..:
  Fly   101 --------------LPPVKATSFIYRHLILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAV 151

  Fly   208 NGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLLDLNH------------RLTAIYDIQVTLFMAT 260
            ..:.|.|...:.|.|              .:|..|:|            ||...:..:||..::.
  Fly   152 RARYLQMMVLVDRLD--------------GKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSH 202

  Fly   261 LFSVNIIVGHVLVI-CWINITRFSLLVIFL--------LFPQAL------IINFWDLWQGIAFCD 310
            ||.:::::.:||.: .||.:.....:|.:|        ||.|.:      :|..|.:      |.
  Fly   203 LFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSI------CA 261

  Fly   311 LAESTGKKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLLDINYE--MGFRMIIT 373
            .:.....|:..:.:...|:.........::..|.|......:::...|:..:|.:  .|....|.
  Fly   262 ASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFIL 326

  Fly   374 NILYVVFLVQF 384
            ..| |:|| ||
  Fly   327 EAL-VIFL-QF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 63/336 (19%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 61/334 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.