DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and egl-47

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001023728.1 Gene:egl-47 / 183687 WormBaseID:WBGene00001211 Length:522 Species:Caenorhabditis elegans


Alignment Length:406 Identity:82/406 - (20%)
Similarity:142/406 - (34%) Gaps:172/406 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TIRATLYGSWVLGLFPFTFD--SRKRRLNRS--------------------------KWLLAY-- 52
            ::|:.|:...:|.:||.|.|  ||::|.:||                          |.|:.|  
 Worm   109 SLRSILFLFRLLAIFPATTDRKSRRKRNHRSIIKLILYVNYIVLAVLLNSFLIKMNFKVLMLYKH 173

  Fly    53 --GL---------------VLNLTLLVLSMLPSTDDHNSVK----VEVFQR-------------- 82
              ||               |:|:.::|||.:........:|    |:|..|              
 Worm   174 KFGLMHTGTVASMITATKPVINVFVIVLSAIKFKSHQRLLKTIDMVDVCFRSAFGVSPPLRIYKF 238

  Fly    83 -----------NPLVKQVEE-------------------LVEVISL---ITTLVTHL-----RTF 109
                       :.|:.:|.|                   ||.|:||   |..|..||     |.:
 Worm   239 VFFFTLLIIFFSALILKVVEFVGTGEIFGEHILTDCSFILVPVLSLWNIIPLLYYHLYNILVRFY 303

  Fly   110 SRSSELVEILNELLVLDKNHFSKLMLSECHT------------FN---RYVIEKGLVIILEIGSS 159
            .|:  |::.:|.  ...|.|||.....|..|            ||   .:.:...|:::     .
 Worm   304 CRT--LIKSMNR--EHKKRHFSLKFYYEQFTRITNVQEAVGDVFNPLLLFSLAWSLLVL-----C 359

  Fly   160 LVLYF---------------GIPNSK------IVVYEAVCIYIVQLEVLMVVMHFHLAVIYIYRY 203
            |.|||               .:.|.|      |.|:..:|....|  |:|.::|    :|.|...
 Worm   360 LTLYFLSEPTSTLLVPITPEQVTNPKIREKLNITVHVKICWAAYQ--VVMAILH----IIIICST 418

  Fly   204 LWIIN---GQLLDMASRLRRGDSVDPDRIQLLLWLYSRLLDLNHRLTAIYDIQVTLFMA------ 259
            ..:.|   .|:::...|:....:.|.||.|:..::        |::|..:...:|::.|      
 Worm   419 GMMTNETTRQIVNAVLRIVPDANADLDRFQISCFV--------HKMTTQFMWGMTVWRAFPLERT 475

  Fly   260 TLFS-VNIIVGHVLVI 274
            |.|: :::||.:.|::
 Worm   476 TFFTLISVIVTYSLLL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 82/405 (20%)
egl-47NP_001023728.1 7tm_7 110..495 CDD:303125 82/405 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.