DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr59a

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:137/393 - (34%) Gaps:86/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARFT-IRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTLLVLSMLPSTDDHNSVKVE 78
            :|.| |...|..:..|.|.|..|....:.|:.:.|:.:|       :.|...:..|.::.::...
  Fly    30 SRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSY-------MRVTPYIMCTINYAAIAYT 87

  Fly    79 VFQ---RNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLMLSECHT 140
            :..   |:.::..::.:|                      :|:..|:|...|...|.|       
  Fly    88 LISRCYRDAMLMDLQRIV----------------------LEVNREMLRTGKKMNSLL------- 123

  Fly   141 FNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVC---IYIVQLEVLMVVMHFHLAVI-YIY 201
             .|....|...:.....|.::..| |...|...:..:|   :..:.|.:|.|...|:...: :|.
  Fly   124 -RRMFFLKTFTLTYSCLSYILAVF-IYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLWHIA 186

  Fly   202 RYLWIINGQL----------LDMASRLRRGDSVDPDRIQLLLWLYSRLLDLN-HRLTAIYDIQVT 255
            |....:|.||          |:..|:..||           ||...|.|... .|:...|..|:.
  Fly   187 RGYDFVNQQLNEIVACQSMDLERKSKELRG-----------LWALHRNLSYTARRINKHYGPQML 240

  Fly   256 LFMATLFSVNIIVGHVLVICWINITRFSLLVIFLLFPQALIINFW----DLWQGIAFCDLAESTG 316
            ......|..:||...:..|........||..||    .:||  :|    |.:.....|||.    
  Fly   241 AMRFDYFIFSIINACIGTIYSTTDQEPSLEKIF----GSLI--YWVRSFDFFLNDYICDLV---- 295

  Fly   317 KKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVFL 381
            .:..|..|.|....:|..|    ::.:.::.|..||.:...||..:|.....:|:.:.:::...|
  Fly   296 SEYQMQPKFFAPESSMSNE----LSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSML 356

  Fly   382 VQF 384
            .||
  Fly   357 FQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 76/388 (20%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 78/393 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.