DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr93b

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:426 Identity:84/426 - (19%)
Similarity:173/426 - (40%) Gaps:93/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIHRICKGLARFT---IRAT-LYGSWVLGLFPFTF---DSRKRRLNRSKWLLAYGLVLNLTLLVL 63
            ||.| |..::|.:   :|:. |||:: .|:..|..   ||:...:||..:|        ...||:
  Fly     9 RILR-CLNVSRISAILLRSCFLYGTF-FGVITFRIERKDSQLVAINRRGYL--------WICLVI 63

  Fly    64 SMLPS----------TDDHNSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEI 118
            .:|.|          :..:..:.:..|....|:.         .||.:::..:..|....||:.:
  Fly    64 RLLASCFYGYSYDAWSGQYEDMYLRAFFGFRLIG---------CLICSVIILVMQFWFGEELINL 119

  Fly   119 LNELLVLDKNHFSKLMLSECHTFNRYVIEKG-----LVIILEIGSSLVLY--FGIPNSKIVVYEA 176
            :|..|.|    |.::........||:    |     |::..::.|.|.::  |.:..|...:...
  Fly   120 VNRFLQL----FRRMQSLTNSPKNRF----GDRAEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTL 176

  Fly   177 VCIYIVQLEVLMVVMHF----HLAVIYIYRYLWIINGQL-LDMASRLR--RGD------SVDPDR 228
            ||.....:...|:. |.    :|::..:||.|   |..: ..:.::||  .|:      :..|.|
  Fly   177 VCDLYTSVGTGMIT-HLCFVGYLSIGVLYRDL---NNYVDCQLRAQLRSLNGENNSFRNNPQPTR 237

  Fly   229 -----IQLLLWLYSRLLDLNHRLTAIYDIQVTLFMA-TLFSVNIIVGHVLVICWINITRFSLLVI 287
                 :...|:||..:..::.....::|:.:.|.:| :|.:::::..|.::....:...:.|::.
  Fly   238 QAISNLDKCLYLYDEIHQVSRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLVIK 302

  Fly   288 FLLFPQALIINFWDLWQGIAFCDLAESTGKKTSMILKLFNDMENM----DQETERRVTEFTLFCS 348
            .|:....|.::             ..|....:.:|.:|  ..||.    .|...:::..|.....
  Fly   303 LLIDVVLLTMS-------------VHSAVNGSRLIRRL--SFENFYVTDSQSYHQKLELFLGRLQ 352

  Fly   349 HRRLKVCHLGLLDINYEMGFRMIITNILYVVFLVQF 384
            |:.|:|..|||.:::.|:....:...:.|:|||||:
  Fly   353 HQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 79/410 (19%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 79/410 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.