DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr39b

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:394 Identity:73/394 - (18%)
Similarity:163/394 - (41%) Gaps:78/394 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTLLVLSM-LPSTDD---HNSVKVEVFQRNPLVKQ 88
            :|||.|::....:.:..: |...|..::||.....:|: .|.:.:   ...|.|.||        
  Fly    14 LLGLVPWSESCAQSKFVQ-KVYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVF-------- 69

  Fly    89 VEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLD-KNHFSKLMLSECHTFNRY--VIEKGL 150
            |..:|.|..:|..::.|...:.|....::.|...|..: |.|..:|      .:..|  ::..|:
  Fly    70 VARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRL------KWQSYAKILALGI 128

  Fly   151 VIILEIGSSLVLYFGIPNSKIVVYEA-VCIYIVQLEVLMVVMH-----FHLAVIYIYR------Y 203
            ..::.:..|  :|..:..|.:..:.: :.|.|::::.::|:::     .|::::.|..      :
  Fly   129 GFLVTVLPS--IYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGIRLQNVLECH 191

  Fly   204 LWIINGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLLDLNHRLTAIYDIQVTLFMATLFSVNIIV 268
            |...|..|...|:||        ..::.||.|....:.|::..|...|         ||..:|:.
  Fly   192 LMGANCTLDGNANRL--------CSLEFLLALKQSHMQLHYLFTHFND---------LFGWSILG 239

  Fly   269 GHVLV-------ICW-----INITRFS-LLVIFLLFPQALIINFWDLWQGIAFCDLAESTGKKTS 320
            .:|::       |.|     :.:..:. |...|.:|    :.:|:::   :.||...|...:::.
  Fly   240 TYVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVF----VPSFFNI---LVFCRCGEFCQRQSV 297

  Fly   321 MI---LKLFNDMENMDQETERR--VTEFTLFCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVF 380
            :|   |:..:...::.:||..:  :.||.|......|.:...|.:..:..:...::...:.|::.
  Fly   298 LIGSYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIV 362

  Fly   381 LVQF 384
            |:||
  Fly   363 LMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 73/394 (19%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 73/394 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.