DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr39a

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:466 Identity:76/466 - (16%)
Similarity:160/466 - (34%) Gaps:167/466 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPKRI---HRICKGLARFTIRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTLLVLS 64
            ||..:   :|:|:               .||:|...::..|::....:.:|.|  :::..|... 
  Fly     4 QPGELCAYYRLCR---------------YLGIFCIDYNPTKKKFRLRRSVLCY--IVHFALQAY- 50

  Fly    65 MLPSTDDHNSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNH 129
                                          ::..|:.:||:.|...:|.         |....||
  Fly    51 ------------------------------LVGCISVMVTYWRRCFKSE---------LTTTGNH 76

  Fly   130 FSKLMLSECHTFNRYVIEKGLVIILEIGSSLVLYFGIPNSKI----------------------- 171
            |.:|::         ||..|   ||.:.::.:::...|:.:|                       
  Fly    77 FDRLVM---------VIALG---ILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLANVRLLLPKRL 129

  Fly   172 --------VVYEA----VCIY--IVQLEVLMVV---------------MHFHLAVIYIYRYL--W 205
                    |||.|    .||:  :.....|.|:               |..:..:::|.|.:  |
  Fly   130 LWLIIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDW 194

  Fly   206 ---IINGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLLDLNHRLTAIYDIQVTLFMATLFSVNII 267
               .||. ::|.::.|:   ...|:|::|.:     .|:::.||..:.:.:::|          :
  Fly   195 NQSQINA-IIDESADLK---MTSPNRLRLRV-----CLEMHDRLMLLCNDEISL----------V 240

  Fly   268 VGHVLVICW----INITRFSLLVIFLLFPQALIINFWD--LWQGIAFCDLAES---------TGK 317
            .|.:..:.|    :::|....|.:.:...:::::....  :|....|...|.|         ..|
  Fly   241 YGFIAWLSWMFASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVTIQANK 305

  Fly   318 KTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVFLV 382
            ...|:.|:......:|    |.:.:|.|....::..:...|...::....|::......|:|.||
  Fly   306 TAKMLTKVPRTGTGLD----RMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILV 366

  Fly   383 QFDYMNLKFKT 393
            ||..|....|:
  Fly   367 QFKEMENSTKS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 70/440 (16%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 72/455 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.