DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22a and Gr98b

DIOPT Version :9

Sequence 1:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:429 Identity:89/429 - (20%)
Similarity:160/429 - (37%) Gaps:87/429 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPKRIHRICKGLARFTIRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLT-LLVLS 64
            ::|..|:      |||......::..:.|...|.:|.....|  |.:|.|..|.|...| :|...
  Fly     2 VAQKSRL------LARAFPYLDIFSVFALTPPPQSFGHTPHR--RLRWYLMTGYVFYATAILATV 58

  Fly    65 MLPSTDDHNSVKVEVFQRN--PLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNEL--LVL 125
            .:.|..:..::..||.:.|  ...:.:..:.:.:..|..:..||........|..|..::  |.:
  Fly    59 FIVSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYSIMAIANHLNMLINYRRLGGIYKDIADLEM 123

  Fly   126 DKNHFSKLMLSECHTFN---RYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVCIYIVQL--E 185
            |.:..|:....:...|:   |..:..|:.:||.:||       :|...:.........::::  |
  Fly   124 DMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGS-------MPRLTMTAMGPFVSTLLKILTE 181

  Fly   186 VLMVV-----MHFHLAVIYIYRYLWIINGQLLDMASRLRR---------GDSVDPDRIQLLLWLY 236
            .:|::     :.:.:.|:.||           ::..||||         .|....|.:|.|....
  Fly   182 FVMIMQQLKSLEYCVFVLIIY-----------ELVLRLRRTLSQLQEEFQDCEQQDMLQALCVAL 235

  Fly   237 SR---LLDLNHRLTAIYDIQVTLFMATLFSVN-IIVGHVLVICWINITRF--------------S 283
            .|   ||....||........|..|..||..| :.:.|  ::.|..|.:|              |
  Fly   236 KRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGLTILH--MVNWAYINKFLYDSCCQYERFLVCS 298

  Fly   284 LLVIFLLFPQAL---IINFWDLWQGIAFCDLAESTGKKTSMILKLFNDMENMDQETERRVTEFTL 345
            .|::.||.|..|   .||.::.:..|.......|.....:|:              .|.:.|::|
  Fly   299 TLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNFAML--------------TRGLREYSL 349

  Fly   346 FCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVFLVQF 384
            ...|.:|:....||.|||.:....:::|...|::.|:||
  Fly   350 QMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 84/411 (20%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 84/412 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.