DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP2S1 and AP-2sigma

DIOPT Version :9

Sequence 1:XP_011524725.1 Gene:AP2S1 / 1175 HGNCID:565 Length:172 Species:Homo sapiens
Sequence 2:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster


Alignment Length:155 Identity:135/155 - (87%)
Similarity:137/155 - (88%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    18 IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEVLAISVADSLSVLQF 82
            ||||||||||||||||||||.|||||||||||||||||||||||||||||              |
  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVE--------------F 52

Human    83 RNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEM 147
            |||||:||||||||||||||||||||.||||||||||||||||||||||||||||||||:|||||
  Fly    53 RNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEM 117

Human   148 FLAGEIRETSQTKVLKQLLMLQSLE 172
            |||||||||||||||||||.|.|||
  Fly   118 FLAGEIRETSQTKVLKQLLTLNSLE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP2S1XP_011524725.1 Clat_adaptor_s 18..172 CDD:250451 133/153 (87%)
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 132/152 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158747
Domainoid 1 1.000 278 1.000 Domainoid score I1727
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3001
Inparanoid 1 1.050 280 1.000 Inparanoid score I2909
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - oto91254
orthoMCL 1 0.900 - - OOG6_102766
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R63
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.