DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr98d

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster


Alignment Length:384 Identity:93/384 - (24%)
Similarity:164/384 - (42%) Gaps:58/384 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYRFDSRNGQLKRSRFLLFYG---LILNFFLLLKMVCSGG----QKLGIPEAFARNS--VLENTH 86
            |.:|.:|... ||.|.::..|   .:::..|::...|...    || .|.:..|.:|  |:.||.
  Fly    27 PIQFFTRTLH-KRRRGIVILGYACYLISISLMVIYECYANIVALQK-DIHKFHAEDSSKVMGNTQ 89

  Fly    87 YTTGMLAVFSCVVIH-FLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQK--W--- 145
            ... ::|:|....:: .|||....|:.|...:|.:       .||...    :.||.|:  |   
  Fly    90 KVL-VVAMFVWNQLNILLNFRRLARIYDDIADLEI-------DLNNAS----SGFVGQRHWWRFR 142

  Fly   146 ----LSV-------IGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRY 199
                |||       :||...:..:|.| |..:::.:::....|:.....|.  .|.:.|||||..
  Fly   143 FRLALSVGLWIVLLVGLTPRFTLVALG-PYLHWTNKVLTEIILIMLQLKCT--EYCVFVLLIYEL 204

  Fly   200 LWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKGY---MVATYEYHMTLVLTTGLASN 261
              ::.|:.:....:::|:.:.....:::.....:|...|.|.   :|.....:.||.||.....|
  Fly   205 --ILRGRHILQQISVELEGNQSRDSVQELCVALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYN 267

  Fly   262 ---FLAIYSWIVLDISMNINFI--YLLIFPLFLLVNVWNLWLSIAASDLAENAGKSTQTVLKLFA 321
               .|.|.:|.::. |:|.|..  |..: ...||::: |::||...|:.......|...||....
  Fly   268 ELTILQIVNWALIK-SVNPNECCQYRRV-GTCLLLSI-NIFLSCLYSEFCIQTYNSISRVLHQMY 329

  Fly   322 DLEVKD--IELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378
            .|...:  :.|:..:.|::|...|.:..|...|||.||.|....|::|.|.|:|.::||
  Fly   330 CLSAAEDYLILKMGLREYSLQMEHLKLIFTCGGLFDINLKFFGGMVVTLFGYIIILVQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 93/384 (24%)
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 93/384 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.