DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr98a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:360 Identity:73/360 - (20%)
Similarity:124/360 - (34%) Gaps:120/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CWIILKATL-YSSWFLGVFPYRFD----------------------------------------S 36
            |:::|..:| :||::...|.|.||                                        .
  Fly    38 CYVLLFVSLGFSSYWRFSFDYEFDYDFLNDRFSSTIDLSNFVALVLGHAIIVLELLWGNCSKDVD 102

  Fly    37 RNGQLKRSRFLL-----------------FYG-LILNFFLLLKMVCSGGQKLGIPEAFARNSVL- 82
            |..|...|:..|                 .|| ||:.:.:.:.:.....:.|.|...::....| 
  Fly   103 RQLQAIHSQIKLQLGTSNSTDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLA 167

  Fly    83 ---ENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFA--SLNETKCPKFNSFVI 142
               |.|.|...:|.::..:::      |.:.|.|   ||....|:.::  .|:..|..|..:...
  Fly   168 RFSEFTLYCAVILFIYQELIV------GGSNVLD---ELYRTRYEMWSIRRLSLQKLAKLQAIHN 223

  Fly   143 QKW-----------LSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLI 196
            ..|           ||:|.||:.:......||       ..|..|.|:.: ...:.||...|..|
  Fly   224 SLWQAIRCLECYFQLSLITLLMKFFIDTSALP-------YWLYLSRVEHT-RVAVQHYVATVECI 280

  Fly   197 YRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLY------RRLLELKGYMVA--------TYE 247
                     :|||:|....| |:...:..||:||::      ||..:|...:.:        .|:
  Fly   281 ---------KLLEIVVPCYL-CTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYK 335

  Fly   248 YH---MTLVLTTGLASNFLAIYSWIVLDISMNINF 279
            :.   |..:.|..|...|..:.|:||:.|..:|||
  Fly   336 FSAGGMVDINTEMLGKFFFGMISYIVICIQFSINF 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 72/356 (20%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 71/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.