DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr63a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:408 Identity:75/408 - (18%)
Similarity:144/408 - (35%) Gaps:112/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SWFL---GVFP-YRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFARNSVLEN 84
            :|||   ||.| .|......:.:.:.....|.::  ||:||  .|..|.       .|.|.:   
  Fly    81 NWFLRIIGVLPIVRHGPARAKFEMNSASFIYSVV--FFVLL--ACYVGY-------VANNRI--- 131

  Fly    85 THYTTGMLAVFSCVVIHFL------------NFWGSTR-VQDLAN---ELLVLEYQQFASLNETK 133
             |....:...|...||.:|            ..|...| :..|.|   :..||.||    ::...
  Fly   132 -HIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQ----ISGHS 191

  Fly   134 CP-KFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIY 197
            .| |.....:  :::::..:||.||:..    .:.::..:.||.:|.:....|:      ..::.
  Fly   192 LPLKLRQKAV--YIAIVLPILSVLSVVI----THVTMSDLNINQVVPYCILDNL------TAMLG 244

  Fly   198 RYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASN- 261
            .:.:||              |...|.........:::.|:..|......:|.:..:..:.|..: 
  Fly   245 AWWFLI--------------CEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDT 295

  Fly   262 ---------FLAIYSWIVLDISMNINFIYLLIFPL----------FLLVNVWNLWLSIAASDLAE 307
                     |:::|.:.::.:|     ||.|:..|          ..:..:||:.|.....|.|.
  Fly   296 GNALCYTFVFMSLYLFFIITLS-----IYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAH 355

  Fly   308 NAGKSTQTVLK---LFADLEVKDIELERSVNEF---------ALLCGHCQFNFHVCGLFTINYKM 360
            .|..:.:|..:   |..:|...:.:.:..:|.|         .:.||         |.|.:|..:
  Fly   356 YASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCG---------GFFDVNRTL 411

  Fly   361 GFQMIITSFLYLIYMIQF 378
            ...::.|...||:.::||
  Fly   412 FKGLLTTMVTYLVVLLQF 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 75/408 (18%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 75/408 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.