DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr32a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:352 Identity:72/352 - (20%)
Similarity:132/352 - (37%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQ---QF-ASLNE------------TKCPKF 137
            |..|.||.|.  |     .:|.:..:.||:|.|:.:   || |:|::            |.|..:
  Fly   140 TYTLTVFVCA--H-----NTTSMLRIMNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQAY 197

  Fly   138 NSFVIQKWLSVIGLL--LSYLSIA-YGLPGNNFSVEMVLINSL-----VQFSF------------ 182
              .::.|..:|.|.:  .||:.:| ||:.....:..:|..::|     ::|.|            
  Fly   198 --IIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTYGQ 260

  Fly   183 --------------------NCN---IMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSR 224
                                |.|   :.|:....|.|||    ::.:||.:...:...|::    
  Fly   261 QHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYR----MHNKLLRIYKGINDCCNL---- 317

  Fly   225 IRKYLSLYRRLLELKGYMVATYEYHMTLVLT-TGLAS-NFLA-IYSWIVLDISMNINFIYLLIFP 286
                  :....|....|.|.|..|::.:.:| .|:.| |.|. .::|:.|.:|:           
  Fly   318 ------ILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVSL----------- 365

  Fly   287 LFLLVNVWNLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVC 351
            |.|        ||.:.......|..::|.:.:::|    |..|.:..:::|.......:..|...
  Fly   366 LAL--------LSRSCGLTTTEANATSQILARVYA----KSKEYQNIIDKFLTKSIKQEVQFTAY 418

  Fly   352 GLFTINYKMGFQMIITSFLYLIYMIQF 378
            |.|.|:....|::......||:.:|||
  Fly   419 GFFAIDNSTLFKIFSAVTTYLVILIQF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 72/352 (20%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 72/352 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.