DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr28b

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:381 Identity:69/381 - (18%)
Similarity:137/381 - (35%) Gaps:122/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RFDSRNGQLKRSRFLLFYGLILNF--FLLLKMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVF 95
            :|.:.:.||:.....:.|..:|.|  .:|:.|                  .|.|..:|.|..:|.
  Fly   150 KFHTMDVQLQTVGVKIMYSKVLRFSYMVLISM------------------FLVNVLFTGGTFSVL 196

  Fly    96 ------SCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLS 154
                  ..:.:||                                    :|:||.  :||.:.::
  Fly   197 YSSEVAPTMALHF------------------------------------TFLIQH--TVIAIAIA 223

  Fly   155 YLSIAYGLPGNNFSVEM--VLINSLVQFSFNCNIMHYYIGVLLIYRYLWLING-----QLLEMVT 212
            ..|..      .:.|||  |::|.:::     |:.|.:     ..|.|..:|.     |.|:..:
  Fly   224 LFSCF------TYLVEMRLVMVNKVLK-----NLAHQW-----DTRSLKAVNQKQRSLQCLDSFS 272

  Fly   213 NLKLDCSVDSSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIY--SWIVLDISM 275
            ...:.....:..|::.:.::..:.|    ..||...:.|..|.|.::..||.|.  ::.||:..:
  Fly   273 MYTIVTKDPAEIIQESMEIHHLICE----AAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLL 333

  Fly   276 ----------NINFIYL----LIFPLFLLVNVWNLWLSIAASDLA----ENAGKSTQTVLKLFAD 322
                      .:.|:..    :|..|..::::      :..|:.|    |..|....::|.    
  Fly   334 GKSKRESKFKTVEFVTFFSCQMILYLIAIISI------VEGSNRAIKKSEKTGGIVHSLLN---- 388

  Fly   323 LEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378
             :.|..|::..:.:|::...|.:.||...|||.|:..:.|.:......|||.::||
  Fly   389 -KTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 69/381 (18%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 67/379 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.