DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr36b

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:431 Identity:95/431 - (22%)
Similarity:163/431 - (37%) Gaps:112/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WII--LKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMV----CSGGQKLGI 72
            |::  |||.....:.:|:..:.||.|.|::.:||....|..:.|.|:|:.::    ..|...|..
  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLF 68

  Fly    73 PEAFARNS----VLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETK 133
            ..|...:.    ::.......|::.|        ||.|    :|......||.:..:...:|   
  Fly    69 QSANKLHEYVIIIMSGLKIVAGLITV--------LNRW----LQRGQMMQLVKDVIRLYMIN--- 118

  Fly   134 CPKFNSFVIQKWLSVIGLLL-SYLSIAYGLPGNNFSVEM-----------VLINSLVQFSFNCNI 186
             |:..|.:  :|    |:|| :::|.|..|.....||:.           :|:...|.|..|..|
  Fly   119 -PQLKSMI--RW----GILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAI 176

  Fly   187 MHYYIGVLLI---YR-----------------YLWLINGQLLEMVTNLKLDCSVDSSRIRKYL-S 230
            ..:::.:|||   ||                 :|.|.||..:.....|. |...|...::..| |
  Fly   177 SQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLS-DQLEDIGEVQSQLQS 240

  Fly   231 LYRRLLELKGY--MVATYEYHMTLVLTTGLASNFLAIYSW--IVLDISMNINFIYLLIFPLF--- 288
            :..:|.|:.|.  ::|..||::::|.|:.::   .:||.:  ..|.:|...:.|..::..||   
  Fly   241 MVGQLDEVFGMQGLMAYSEYYLSIVGTSYMS---YSIYKYGPHNLKLSAKTSIIVCILITLFYLD 302

  Fly   289 LLVNVWNLW---------------LSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFA 338
            .|||..|:.               .::.||.|                     ||.||.|.....
  Fly   303 ALVNCNNMLRVLDHHKDFLGLLEERTVFASSL---------------------DIRLEESFESLQ 346

  Fly   339 LLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFD 379
            |.........:|.|:|.|.......|..:..:..|::||||
  Fly   347 LQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 94/426 (22%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 94/426 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.