DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr36c

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:440 Identity:88/440 - (20%)
Similarity:165/440 - (37%) Gaps:122/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLQSRLCWIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILN--FFLLLKMVCSGGQK 69
            ||:|    .:|.|..|...|:|:..:.||...|::...::...|.:.|:  .|.|.....:|...
  Fly     2 DLES----FLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWTGNTN 62

  Fly    70 LGIPEAFARNSVLENTHYTTGMLAVFSCVVIHF---LNFWGSTRVQDLANELLVLEYQQFASLNE 131
            : :...|.|.::|.  .|...:|.....|...|   |.::...::.|||::::    :.:.:..:
  Fly    63 I-VNAIFGRANMLH--EYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVV----RMYVARPQ 120

  Fly   132 TKCPKFNSFVIQKWLSVIGLLLSYL--SIAYGLPGNNFSVEMVLINSLV-----QF--------- 180
            .:       .:.:|    |:|..::  ||..||       :|.::.|.:     ||         
  Fly   121 VR-------RMSRW----GILTKFIFGSITDGL-------QMAMVLSAMGSVDSQFYLGLGLQYW 167

  Fly   181 ---SFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLD---------------CSV-----DS 222
               ..|..:|..::.:|.:.....|||.:|.:::...| |               ||:     :.
  Fly   168 MFVILNMAMMQQHMIMLFVRTQFQLINTELRQVIDEAK-DLLLSPRHQGVFMTKCCSLADQIENI 231

  Fly   223 SRIRKYLSLYRRLLE----LKGYMVATY-EYHMTLVLTTGLA---------------SNFLAIYS 267
            :||:..|......:|    ::|.|  || .|:::.|.|..||               |..:..||
  Fly   232 ARIQSQLQTIMNQMEEVFGIQGAM--TYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYS 294

  Fly   268 WIVLDISMNINFIYLL--IFPLFLLVNVW-NLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIE 329
            |.         |.|.|  :..|.::::|. :.|      ::.:..||.|     :|..|   |:.
  Fly   295 WC---------FFYYLDGMLNLSVMLHVQDDYW------EMLQILGKRT-----IFVGL---DVR 336

  Fly   330 LERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFD 379
            ||.:.....|..........|..|:.:.......|......:.|::||:|
  Fly   337 LEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 85/430 (20%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 85/430 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.