DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr92a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:357 Identity:79/357 - (22%)
Similarity:136/357 - (38%) Gaps:112/357 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQ 143
            |.||:..|....:|::.:..||...:.:....:.||.|:.|.| ::|.:.|.:||.|.|..    
  Fly    78 NRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRL-FRQVSDLFKTKTPGFGG---- 137

  Fly   144 KWLSVIGLLLSYLSIAYGLPGNNFSV--------------EMVLINSLVQFSFNCNIMHYYIGVL 194
             ...:|.:||:.:|.|:......|::              :..|:::...|....:|.:..:|||
  Fly   138 -RRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVL 201

  Fly   195 L--IYRYLWLINGQLLEMVTNL-----KLDCSVDSSRIR-------KYLSLYRRLLELKGYMVAT 245
            .  :.:|::          |||     ||:.|....:||       |.:||||.:          
  Fly   202 YSELNKYVY----------TNLRIQLQKLNTSGSKQKIRRVQNRLEKCISLYREI---------- 246

  Fly   246 YEYHMTLV---LTTGLASNFLA-IYSWIVLDISMNINFIYLLIFPLFLLVNVWNLWLSIAASDLA 306
              ||.:::   |...|.  ||| ||..:::.:   |.|...:.|.|    |.:..|:.:      
  Fly   247 --YHTSIMFHKLFVPLL--FLALIYKVLLIAL---IGFNVAVEFYL----NSFIFWILL------ 294

  Fly   307 ENAGKSTQTVLKLFADLEVKDIELERSVNEFA-------------------------LLCGHCQF 346
               ||.   ||.||    :..:.:|.:||:|.                         |..||  |
  Fly   295 ---GKH---VLDLF----LVTVSVEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGH--F 347

  Fly   347 NFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378
            ...:.|||.:......|.:......|.::.|:
  Fly   348 RVSILGLFDVTQMQYLQFLSALLSGLAFIAQY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 79/357 (22%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 79/357 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.