DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr93b

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:439 Identity:87/439 - (19%)
Similarity:142/439 - (32%) Gaps:182/439 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFAR 78
            ||.|...|.:|.|.|   |.:|:.:||.:......|:|    |.|:..::||             
  Fly    58 WICLVIRLLASCFYG---YSYDAWSGQYEDMYLRAFFG----FRLIGCLICS------------- 102

  Fly    79 NSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSF--- 140
                               |:|..:.||....:.:|.|..|.| :::..||  |..|| |.|   
  Fly   103 -------------------VIILVMQFWFGEELINLVNRFLQL-FRRMQSL--TNSPK-NRFGDR 144

  Fly   141 -----VIQKWLSVI------GLLLS-----------YLSIAYGLPGNNFSVEMVLINSLVQFSFN 183
                 :..|..|::      .|:||           |.|:..|           :|..|      
  Fly   145 AEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDLYTSVGTG-----------MITHL------ 192

  Fly   184 CNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDS-----------------------SRI 225
            |.:.:..||||  ||.|            |..:||.:.:                       |.:
  Fly   193 CFVGYLSIGVL--YRDL------------NNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNL 243

  Fly   226 RKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLL 290
            .|.|.||..:.::.    .:::....|.|...||.:.||        :||   ..|..|......
  Fly   244 DKCLYLYDEIHQVS----RSFQQLFDLPLFLSLAQSLLA--------MSM---VSYHAILRRQYS 293

  Fly   291 VNVWNLWLSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHV----- 350
            .|:|.|                   |:||..|:.:..:.:..:||...|:......||:|     
  Fly   294 FNLWGL-------------------VIKLLIDVVLLTMSVHSAVNGSRLIRRLSFENFYVTDSQS 339

  Fly   351 ---------------------CGLFTINYKMGFQMIITSFLYLIYMIQF 378
                                 .|||.::.::....:.....||::::|:
  Fly   340 YHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 85/436 (19%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 87/439 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.