DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr28a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:435 Identity:88/435 - (20%)
Similarity:171/435 - (39%) Gaps:115/435 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGVFPYRFD-SRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEA------FARNSVL-- 82
            ||:.|:|.: :...:::.|:|..|.|::...|.:|   |.|   :.:.|.      |.:.::.  
  Fly    28 LGLAPFRLNLNPRKEVQTSKFSFFAGIVHFLFFVL---CFG---ISVKEGDSIIGYFFQTNITRF 86

  Fly    83 -ENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLV----------LEYQQFASLNETKCPK 136
             :.|...||:||:  ..:..|..|.....|..:.|.::|          |:|::..         
  Fly    87 SDGTLRLTGILAM--STIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGMKLDYRRIL--------- 140

  Fly   137 FNSFVIQKWLSVIGLLL---SYLSIAYGLPGNNFSVEMVLINSLVQFSF----NCNIMHYYIGVL 194
            .:||:|.     :|:||   .||.::|.|          |:::.:..||    ...:.|..|. |
  Fly   141 LSSFLIS-----LGMLLFNVIYLCVSYSL----------LVSATISPSFVTFTTFALPHINIS-L 189

  Fly   195 LIYRYLW----------LINGQL-------LEMVTNLKLDCSVDSSRIRKYLSLYRRLLE--LKG 240
            :::::|.          ::|..|       :|.::.|:|.........|:|....|.|:.  :|.
  Fly   190 MVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMKR 254

  Fly   241 YMVATY-----EYHMTLV-----LTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLLVNVWN 295
            |.|.:.     ||.:..|     |...:.......:::.:|.| :.|:|:::|....::|..:.|
  Fly   255 YSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGI-IAISFLFILFDDFYILEAILN 318

  Fly   296 --------------------LWLSIAASDLAENAGK----STQTVLKLFADLEV-KDIELERSVN 335
                                :|..:....:.|.:.:    |:.|...:...|.: .|.||...:.
  Fly   319 PKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHKILNITDDPELRDRLF 383

  Fly   336 EFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDF 380
            ..:|...|.:..|...|||.::..:.|.:...:..|||.:|||.|
  Fly   384 RLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRF 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 88/435 (20%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 88/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.