DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr66a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:190 Identity:35/190 - (18%)
Similarity:82/190 - (43%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LVNKMAIGETVE-SERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFI---- 274
            :|::..:|...: .|:::.|..::..:.::|:.|..::.|.::.:|....:.....:||..    
  Fly   305 MVHESELGNAAKVEEKLNNLCQVHDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQ 369

  Fly   275 ------IYSISLNKSLDFKILVFVQALVINMLDFWLNVEICELAERTG---RQTSTILK---LFN 327
                  ::..:.|..:...:|.:.....:.::  :|:.:..:.::|||   .:...:..   |:.
  Fly   370 YQSIPSLFRSAKNPFITVIVLSYTSGKCVYLI--YLSWKTSQASKRTGISLHKCGVVADDNLLYE 432

  Fly   328 DIENIDEKLERSITDFALFCSHRRLRFHHCGLFYVNYE--MGFRMAITSFLYLLFLIQFD 385
            .:.::..||.....||:.           ||.|.::.|  .|....|||  ||:.||||:
  Fly   433 IVNHLSLKLLNHSVDFSA-----------CGFFTLDMETLYGVSGGITS--YLIILIQFN 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 35/190 (18%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 33/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.