DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr58b

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:322 Identity:73/322 - (22%)
Similarity:134/322 - (41%) Gaps:71/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 HDIQSLSMVSIMLLRSFWKS-GDIERTL---NELEDLQHRYFRNYSLEECISFDRFVLYKGF--S 150
            |.|..|...|::    :||. |.|.|.:   .||.|||.      ||...:.....:||..|  |
  Fly   106 HKIIQLYKYSLI----YWKRFGHITRAIVDKKELLDLQE------SLARIMIRKIILLYSAFLCS 160

  Fly   151 VVLELVSMLVLELGMSPNYSAQFFIGLGSLCLML--LAVLLGASH----FHLAVVFVY----RYV 205
            .||:...:.|:...:...:.|:....|..||:.:  ..||:..:|    .|||:..::    |..
  Fly   161 TVLQYQLLSVINPQIFLAFCARLTHFLHFLCVKMGFFGVLVLLNHQFLVIHLAINALHGRKARKK 225

  Fly   206 WIVNRELLKLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGI 270
            |       |.:..:|.              ::.:.|.|.:|:..::|.....|.::..:..:..:
  Fly   226 W-------KALRSVAA--------------MHLKTLRLARRIFDMFDIANATVFINMFMTAINIL 269

  Fly   271 YFFIIYSISLNKSLDFKILVFVQALVINMLDFWLNVEICELAE-------RTGRQTSTILKLFND 328
            |..:.||.|..||..:.|| |...|::  .:||..:.:.|:.:       .||:|    |:..:|
  Fly   270 YHAVQYSNSSIKSNGWGIL-FGNGLIV--FNFWGTMALMEMLDSVVTSCNNTGQQ----LRQLSD 327

  Fly   329 IENIDEKLERSITDFALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFL-----YLLFLIQFD 385
            :..:..|::|.:..|.:.....||.:..||:..::     :.|..|::     .::.|:|||
  Fly   328 LPKVGPKMQRELDVFTMQLRQNRLVYKICGIVELD-----KPACLSYIGSILSNVIILMQFD 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 73/322 (23%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 73/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.