DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr23a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:278 Identity:64/278 - (23%)
Similarity:116/278 - (41%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LEECISFDRFVLYKGFSVVLELVSMLVLELGM-------SPNYSAQFFIGLGSLCLMLLAVLLGA 191
            |:|.|:|:....:..|:|    ::|||..||:       :|.|:.:..|.........||:.:..
  Fly   101 LDEPIAFEDSDPWLAFTV----LAMLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLPSFLALQVQI 161

  Fly   192 SHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQMV 256
            ..|.|.|:.|...|.....:||.|..:::.......::........||:.||.:|...:: |..|
  Fly   162 ISFILEVMKVNIRVRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLH-YLFV 225

  Fly   257 MVMVSF--LIANVLGIYFFIIYSISLNKSLDFKILVF-VQALVINMLDFWLNVEI--------CE 310
            .:...|  .:..::.::|.|..|.|....:|.:...: :.|:::| |.|..||.:        |:
  Fly   226 RINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWRIYAILLN-LGFIFNVALQMAAACWHCQ 289

  Fly   311 LAERTGRQTSTIL---------KLFNDIENIDEKLERSITDFALFCSHRRLRFHHCGLFYVNYEM 366
            .:...|||...::         ||:||:          :::|:|...|:|........|.:|..:
  Fly   290 QSYNLGRQIGCLISKLVKPQGSKLYNDL----------VSEFSLQTLHQRFVVTAKDFFSLNLHL 344

  Fly   367 GFRMAITSFLYLLFLIQF 384
            ...|......||:.||||
  Fly   345 LSSMFAAVVTYLVILIQF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 64/278 (23%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 49/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.