DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr8a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:313 Identity:66/313 - (21%)
Similarity:114/313 - (36%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLE 154
            |:...|:|:  ..|||  ||.:.:....|..|.:||                 |||:  ..::.|
  Fly   148 GLWQFQALT--QHMLL--FWSTYEPLVWLTYLRNLQ-----------------FVLH--LELLRE 189

  Fly   155 LVSMLVLELGMSPNYS------AQFFIGLGSLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELL 213
            .::.|..|:|:...||      .:.|.|..|                    |:.|          
  Fly   190 QLTGLEREMGLLAEYSRFASETGRSFPGFES--------------------FLRR---------- 224

  Fly   214 KLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSI 278
            :||.|..|               |..:.|:.:.....:::.::.|:::..|...:..| |:.|||
  Fly   225 RLVQKQRI---------------YSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCY-FMYYSI 273

  Fly   279 SLNKSLDFKILVFVQALVINMLDFWLNV----EICELAERTGRQTSTILKLFNDIENI--DE--- 334
            ..|              |||. |::|.|    ||......:......:.::.:.:.||  |.   
  Fly   274 YNN--------------VINN-DYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCC 323

  Fly   335 ---KLERSITDFALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384
               .|...|.:|:|...|:.:|....||..::..:..|||.:...|:::.|||
  Fly   324 SCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 66/313 (21%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 64/311 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.