DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr9a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:292 Identity:64/292 - (21%)
Similarity:114/292 - (39%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSLCLMLLAVLLG 190
            |.:....:|.||         :.|..:||       ||   |...|..||   ...|:|..:|..
  Fly    80 HAWIALSALFEC---------RRFRYLLE-------EL---PPVKATSFI---YRHLILEIILFA 122

  Fly   191 ASHFHLAVVFVYRYVWIVNREL---LKLVNKMAIGETVESERMD-LLLYLYHRL----------- 240
            .:.|.:...:..|.:::.|...   |:.|....:...|..:|:| .|..|:||:           
  Fly   123 CNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLR 187

  Fly   241 LDLGQRLASIYDYQMVMVMVSFLIANVL---------GIYFFIIYSISLNKSLDFKILVFVQALV 296
            ||.. .||.:......:..:|.|:.|||         .:||.:.|.    :.|...:.:|.|.:.
  Fly   188 LDYA-HLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYL----QVLPATLFLFGQVMF 247

  Fly   297 I---NMLDFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERS-ITDFALFCSHRRLRFHHC 357
            :   .::..|   .||..:.|...::..:.:...|:.. ...:||| |..|||......::...|
  Fly   248 VVCPTLIKIW---SICAASHRCVSKSKHLQQQLKDLPG-QTPVERSQIEGFALQIMQDPIQIDVC 308

  Fly   358 GLFYVNYE----MGFRM--AITSFLYLLFLIQ 383
            |::::|.:    |.|.:  |:..||..:.|::
  Fly   309 GIYHLNLQTLAGMFFFILEALVIFLQFVSLVR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 64/292 (22%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 63/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.