DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr10a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:426 Identity:84/426 - (19%)
Similarity:173/426 - (40%) Gaps:110/426 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LYGSWILGVFPFAYDSWTRTLRR--SKWLIAYGFVLNAAFILLV----------VTNDTESETPL 74
            :||..::...|      .|.|:|  ...|||||.:.:...|:::          :|:..:....|
  Fly    28 IYGQVVIDYVP------QRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQL 86

  Fly    75 RMEVFHRNALAEQ--------INGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRN 131
            ...|...|...:.        .|.:| .::::....|           :||..|.|      |:|
  Fly    87 LFYVSFTNTAIKYATVIVTYVANTVH-FEAINQRCTM-----------QRTHLEFE------FKN 133

  Fly   132 YSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSLCLMLLAVLLGASHFHL 196
            ...|....|:.|:.:| |.::  .:.|::...|:...|..   :|.||:..:.:       ||.:
  Fly   134 APQEPKRPFEFFMYFK-FCLI--NLMMMIQVCGIFAQYGE---VGKGSVSQVRV-------HFAI 185

  Fly   197 AVVFVYRYV-------WIVNRELLKLVNKMAIGETVESERMDLL----LYLYH------RLLDLG 244
            ....::.|.       :.:|..:||...:..:......:.||.|    :.|:|      ||.:|.
  Fly   186 YAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGMLLHHCCELSDRLEELR 250

  Fly   245 QRLASIYD----------YQMVMVMVSFLIANVLGIY--FFIIYSISLNKSLDFKILV------- 290
            :|...|:|          :|::.:|:|.||.|:...|  |.::...|| :.:.:.::|       
  Fly   251 RRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSL-EEVSYPVVVGSVYATG 314

  Fly   291 -FVQALVINMLDFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRLRF 354
             ::...::.:::..:.:|:        ...:..::.|.:...:||:|.|.|...:|    ..|.:
  Fly   315 FYIDTYIVALINEHIKLEL--------EAVALTMRRFAEPREMDERLTREIEHLSL----ELLNY 367

  Fly   355 HH---CGLFYVNYEMGFRMAITSFLYLLFLIQFDYW 387
            ..   |||.:::..:.:.:|:|:|.|.:.|:|||.:
  Fly   368 QPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQFDLY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 84/426 (20%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 83/423 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.