DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr28b

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:424 Identity:88/424 - (20%)
Similarity:174/424 - (41%) Gaps:82/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKGALYGSWILGVFPFAYDSWTRTLRRS--KWLIAY--GFVLNAAFIL---LVVTNDTESETP-- 73
            |:...:.::|.|:..|.....|:|.:::  |.:..|  |.:..|.|:.   |.:.|:.||...  
  Fly    45 LRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGYINGIMHIAMFVFAYSLTIYNNCESVASYF 109

  Fly    74 LRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELE--DLQHRYFR---NYS 133
            .|..:.:...|.:.::|...      |:::.|.:|..:..:||.|.:..  |:|.:...   .||
  Fly   110 FRSRITYFGDLMQIVSGFIG------VTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYS 168

  Fly   134 LEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQ-------FFIGLGSLCLMLLAVLLGA 191
              :.:.|...||...|     ||::|......|..||::       .|..|....::.:|:.|  
  Fly   169 --KVLRFSYMVLISMF-----LVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIAL-- 224

  Fly   192 SHFHLAVVFVYRYVWIVNREL-----------LKLVNK----------MAIGETVESERMDLL-- 233
              |......|...:.:||:.|           ||.||:          .::...|..:..:::  
  Fly   225 --FSCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQE 287

  Fly   234 -LYLYHRLLDLGQRLASIYDYQMV-MVMVSFLIANVLGIYFFIIYSISLNKS---LDFKILVFVQ 293
             :.::|.:.:........:.||:: ::.::|||. |...|:  :....|.||   ..||.:.||.
  Fly   288 SMEIHHLICEAAATANKYFTYQLLTIISIAFLII-VFDAYY--VLETLLGKSKRESKFKTVEFVT 349

  Fly   294 ALVINMLDFWLNV--------EICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHR 350
            .....|:.:.:.:        ...:.:|:||....::|......| :.|||::    |::...|.
  Fly   350 FFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAE-VKEKLQQ----FSMQLMHL 409

  Fly   351 RLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384
            ::.|...|||.::..:.|.::.....||:.|:||
  Fly   410 KINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 88/424 (21%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 86/422 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.