DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr36a

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:422 Identity:91/422 - (21%)
Similarity:167/422 - (39%) Gaps:87/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WTGLTLKGALYGSWILGVFPFAYDSWTR----TLRRSKWLIAYGFVLNAAFILLVVTNDTESETP 73
            |.||.||...|...|:|:..|..| |.|    ..:|.   |.:...:|....::::...::.   
  Fly     4 WVGLLLKVLYYYGQIIGLINFEID-WQRGRVVAAQRG---ILFAIAINVLICMVLLLQISKK--- 61

  Fly    74 LRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYSLEECI 138
            ..::|:...|     |.:|....:.|||:.:      :..|...||.... :.:..|   |.||:
  Fly    62 FNLDVYFGRA-----NQLHQYVIIVMVSLRM------ASGISAILNRWRQ-RAQLMR---LVECV 111

  Fly   139 -----------SFDRFVLYKGFSV-----VLEL-VSMLVLE-LGMSPNYSAQFFIGLGSLCLMLL 185
                       ...|:.:...|||     .|:: :||..|: ||.:.      |:|:.|...|..
  Fly   112 LRLFLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNE------FVGMASDFWMSA 170

  Fly   186 AVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVE-------------SERMDLLLYLY 237
            .:.:..|..:|.::||..|..::..|:.:.:::..:...:.             ::|:|.:..|.
  Fly   171 IINMAISQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQ 235

  Fly   238 HRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVINMLDF 302
            ::|..:..:|..::..|.:||...:.|.:|...|  |.||:::|...:..:.|...|||.:...|
  Fly   236 NQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTY--ITYSLAINGIEELHLSVRAAALVFSWFLF 298

  Fly   303 WLNVEICELAERTGRQTSTILKLFND---IENI-----------DEKLERSITDFALFCSHRRLR 353
            :....|..|        ..:||||:|   :|.|           |.:||:|.....|......|:
  Fly   299 YYTSAILNL--------FVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLK 355

  Fly   354 FHHCGLFYVNYEMGFRMAITSFLYLLFLIQFD 385
            .....:|.:.......|..:.....:||||:|
  Fly   356 IEVLDIFTITRSSSAAMIGSIITNSIFLIQYD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 88/417 (21%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 88/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.