DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22e and Gr59b

DIOPT Version :9

Sequence 1:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:355 Identity:74/355 - (20%)
Similarity:143/355 - (40%) Gaps:65/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WLIAYGFVLNAAF-ILLVVTNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLL----- 105
            |.:...|.....| .|:::||:........:.::  ..|:   .|..|.....|..::|.     
  Fly    54 WQVQLVFQQKKTFPKLILITNNVREAVSFLVILY--TVLS---RGFRDTAFKEMQPLLLTLFREE 113

  Fly   106 -RSFWKS-GDIERTLNELEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPN 168
             |..:|. |.:.|:|..|  |..::|....|  |::...|:||...:::  .|::|         
  Fly   114 KRCGFKGIGGVRRSLRIL--LFVKFFTLSWL--CVTDVLFLLYSTDALI--WVNVL--------- 163

  Fly   169 YSAQFFIGLGSLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLL 233
               :||....:..::.: |.:|   :.||:..:.|....|||.|.::|...:..:..|.:.    
  Fly   164 ---RFFFKCNTNNILEM-VPMG---YFLALWHIARGFDCVNRRLDQIVKSKSTRKHRELQH---- 217

  Fly   234 LYLYHR-LLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVI 297
            |:|.|. |......:..||..||:.......:..|:..|:..:::..|:....:.:...|| ..:
  Fly   218 LWLLHACLTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAVFTFDLSTPFFWVVYGSVQ-YHV 281

  Fly   298 NMLDFWLNVEICELAERTGRQTSTILKLFNDIENIDE--------KLERSITDFALFCSHRRLRF 354
            ..||::|...:|::|                :|..|.        :..:.|:.:.::.:..:|:.
  Fly   282 RCLDYYLIDNMCDVA----------------VEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQL 330

  Fly   355 HHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384
            ..||||..|..|.|.|..:...|:|.|:||
  Fly   331 WSCGLFQANRSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 74/355 (21%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 74/355 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.