DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr59f

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:427 Identity:83/427 - (19%)
Similarity:156/427 - (36%) Gaps:124/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KAIKKTIFGYINGIMHIAMFVFAYSLTIYNNCESVASYFFRS-----RITYFGDLMQIVSG---- 126
            |.:.:|:|    .::.|::......:||...|   .:.|:|.     .|.::|   ..|.|    
  Fly    31 KELYRTLF----WLLLISVLANTAPITILPGC---PNRFYRLVHLSWMILWYG---LFVLGSYWE 85

  Fly   127 FIGVTV------IYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYSKVL-------------- 171
            |:.||.      .||.|      :|..:...|...:.|.|...:....|::              
  Fly    86 FVLVTTQRVSLDRYLNA------IESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTI 144

  Fly   172 ---RFSYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFT-----FLIQHTVIAI-------A 221
               |....:.:.:|||      |.|:.|         |:.|.     |::..::::|       .
  Fly   145 DCNRTKRFIRLQLFLV------GIFACL---------AIFFNIWTHKFVVYRSILSINSYVMPNI 194

  Fly   222 IALFSCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQ 286
            |:..|...|.:         :|:.:|  |..|.|  ....:|.|..|.|          |.....
  Fly   195 ISSISFAQYYL---------LLQGIA--WRQRRL--TEGLERELTHLHS----------PRISEV 236

  Fly   287 ESMEIHHL-ICEAAATANKYFTYQLLTIISIAFL---IIVFDAYYVLETLLGKSKRESKFKTVEF 347
            :.:.:||. :.:.....|:.|.|.:|.:....||   :::|..|..:|.           .::..
  Fly   237 QKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVYQGIEN-----------PSMAD 290

  Fly   348 VTFFSCQMILYLI----AIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSA--EVKEKLQQFSMQL 406
            .|.:.| |:|:|.    .:.||:. .|::|:....|   ..:||::...|  ::::.:..|.:|:
  Fly   291 FTKWVC-MLLWLAMHVGKVCSILH-FNQSIQNEHST---CLTLLSRVSYARKDIQDTITHFIIQM 350

  Fly   407 MHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443
            ..........|:.|:|.....|:..|...:.|.|||:
  Fly   351 RTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 82/425 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 76/390 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.