DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr9a

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:367 Identity:81/367 - (22%)
Similarity:151/367 - (41%) Gaps:73/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVG---------------V 163
            :|.:..|..:|.|:.|            .||.|.|.....:.:.::.||               |
  Fly     9 LTGYFQLCGLVCGWSG------------SRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESV 61

  Fly   164 KIMYSKVL---RFSYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIALF 225
            ...::||:   ..:|.::.:...::.||....|..|. .|:.|..|.  :|:.:|.:  :.|.||
  Fly    62 PAYFAKVIMGVNMAYKMIHAWIALSALFECRRFRYLL-EELPPVKAT--SFIYRHLI--LEIILF 121

  Fly   226 SCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKA-----------VNQKQRSL--QCLDSFSMYTIV 277
            :|..:||.....:....|:||.:.:..::::|           ::.|...|  :.:...|.|..:
  Fly   122 ACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTL 186

  Fly   278 TKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGKSKRESKF 342
            ..|.|.:.:.:..:.||.         ..:..||.::.:...|||.:.|:::..|.........|
  Fly   187 RLDYAHLAKVTRSLSHLF---------GLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLF 242

  Fly   343 KTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLM 407
            ..|.||.   |..   ||.|.||...|:|.:.||:.....:..|..:|...  :.:::.|::|:|
  Fly   243 GQVMFVV---CPT---LIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVE--RSQIEGFALQIM 299

  Fly   408 HLKINFTAAGLFNID-RTL---YFTISGALTTYLIILLQFTS 445
            ...|.....|::::: :||   :|.|..|    |:|.|||.|
  Fly   300 QDPIQIDVCGIYHLNLQTLAGMFFFILEA----LVIFLQFVS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 78/363 (21%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 78/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.