DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr22c

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:381 Identity:69/381 - (18%)
Similarity:137/381 - (35%) Gaps:122/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KFHTMDVQLQTVGVKIMYSKVLRFSYMVLISM------------------FLVNVLFTGGTFSVL 196
            :|.:.:.||:.....:.|..:|.|  .:|:.|                  .|.|..:|.|..:|.
  Fly    33 RFDSRNGQLKRSRFLLFYGLILNF--FLLLKMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVF 95

  Fly   197 YSSEVAPTMALHF------------------------------------TFLIQH--TVIAIAIA 223
                  ..:.:||                                    :|:||.  :||.:.::
  Fly    96 ------SCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLS 154

  Fly   224 LFSCF------TYLVEMRLVMVNKVLK-----NLAHQW-----DTRSLKAVNQKQRSLQCLDSFS 272
            ..|..      .:.|||  |::|.:::     |:.|.:     ..|.|..:|.     |.|:..:
  Fly   155 YLSIAYGLPGNNFSVEM--VLINSLVQFSFNCNIMHYYIGVLLIYRYLWLING-----QLLEMVT 212

  Fly   273 MYTIVTKDPAEIIQESMEIHHLICE----AAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLL 333
            ...:.....:..|::.:.::..:.|    ..||...:.|..|.|.::..||.|.  ::.||:..:
  Fly   213 NLKLDCSVDSSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIY--SWIVLDISM 275

  Fly   334 GKSKRESKFKTVEFVTFFSCQMILYLIAIISI------VEGSNRAIKKSEKTGGIVHSLLN---- 388
                      .:.|:..    :|..|..::::      :..|:.|    |..|....::|.    
  Fly   276 ----------NINFIYL----LIFPLFLLVNVWNLWLSIAASDLA----ENAGKSTQTVLKLFAD 322

  Fly   389 -KTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443
             :.|..|::..:.:|::...|.:.||...|||.|:..:.|.:......|||.::||
  Fly   323 LEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 67/379 (18%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 69/381 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.