DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr22e

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:424 Identity:88/424 - (20%)
Similarity:174/424 - (41%) Gaps:82/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGYINGIMHIAMFVFAYSLTIYNNCESVASYF 109
            |:...:.::|.|:..|.....|:|.:::  |.:..|  |.:..|.|:.   |.:.|:.||...  
  Fly    18 LKGALYGSWILGVFPFAYDSWTRTLRRS--KWLIAY--GFVLNAAFIL---LVVTNDTESETP-- 73

  Fly   110 FRSRITYFGDLMQIVSGFIG------VTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYS 168
            .|..:.:...|.:.::|...      |:::.|.:|..:..:||.|.:..  |:|.:...   .||
  Fly    74 LRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELE--DLQHRYFR---NYS 133

  Fly   169 --KVLRFSYMVLISMF-----LVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIAL-- 224
              :.:.|...||...|     ||::|......|..||::       .|..|....::.:|:.|  
  Fly   134 LEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQ-------FFIGLGSLCLMLLAVLLGA 191

  Fly   225 --FSCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQE 287
              |......|...:.:||:.|           ||.||:          .::...|..:..:::  
  Fly   192 SHFHLAVVFVYRYVWIVNREL-----------LKLVNK----------MAIGETVESERMDLL-- 233

  Fly   288 SMEIHHLICEAAATANKYFTYQLLTIISIAFLII-VFDAYY--VLETLLGKSKRESKFKTVEFVT 349
             :.::|.:.:........:.||:: ::.::|||. |...|:  :....|.||   ..||.:.||.
  Fly   234 -LYLYHRLLDLGQRLASIYDYQMV-MVMVSFLIANVLGIYFFIIYSISLNKS---LDFKILVFVQ 293

  Fly   350 FFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAE-VKEKLQQ----FSMQLMHL 409
            .....|:.:.:.:        ...:.:|:||....::|......| :.|||::    |::...|.
  Fly   294 ALVINMLDFWLNV--------EICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHR 350

  Fly   410 KINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443
            ::.|...|||.::..:.|.::.....||:.|:||
  Fly   351 RLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 86/422 (20%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 88/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.