DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr92a

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:450 Identity:99/450 - (22%)
Similarity:146/450 - (32%) Gaps:147/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MFVFAYSLTIYNNCESVASYFFRSRITYFGDLMQIVSGFIGVTVIYL-------TAFVPN----- 141
            ||.|.:.::......|:..|.||            .:.||||....|       |.|:.|     
  Fly     1 MFEFLHQMSAPKLSTSILRYIFR------------YAQFIGVIFFCLHTRKDDKTVFIRNWLKWL 53

  Fly   142 ---HRL------------------ERCLQKFHTMDVQLQ--TVGVKIMYSKVLRFSYMV-LISMF 182
               ||:                  .|.||..|.|.:.|.  .|.|.:.| .:.|...:: ||:.|
  Fly    54 NVTHRIITFTRFFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCY-HIFRGPEIIDLINQF 117

  Fly   183 L-----VNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIAL-FS--------CFTYLVE 233
            |     |:.||...|.......|:...:....:|..:.|.:...|.. ||        |..|||.
  Fly   118 LRLFRQVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVS 182

  Fly   234 MRLVMV-----------------NK-VLKNLAHQWDTRSLKAVNQKQRSLQ-----CLDSFSMYT 275
            ...:.:                 || |..||..|....:.....||.|.:|     |:   |:| 
  Fly   183 ATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCI---SLY- 243

  Fly   276 IVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAY---YVLETLLGKSK 337
                  .||...|:..|.|.......|   ..|::|.|..|.|.:.| :.|   ::...||||. 
  Fly   244 ------REIYHTSIMFHKLFVPLLFLA---LIYKVLLIALIGFNVAV-EFYLNSFIFWILLGKH- 297

  Fly   338 RESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQQF 402
                              :|.|..:...|||:             |:..||..........|.:|
  Fly   298 ------------------VLDLFLVTVSVEGA-------------VNQFLNIGMQFGNVGDLSKF 331

  Fly   403 SMQL----MHLKI---NFTAAGLFNIDRTLYFTISGALTTYLIILLQFTSNSPNNGYGNG 455
            ...|    :||::   ..:..|||::.:..|.....||.:.|..:.|:...     .|||
  Fly   332 QTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ-----VGNG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 95/436 (22%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 92/422 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.