DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr93d

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster


Alignment Length:240 Identity:49/240 - (20%)
Similarity:104/240 - (43%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HFTFLIQHTVIAIAIALFSCFTYLVEMRL-VMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSF 271
            |..:.:.:|.:.|......||.::..:.| |:..::..||  ::::....|..:||:.::...|.
  Fly   167 HIIWWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNL--RFESGFQTAFLRKQQRIRVQKSM 229

  Fly   272 SMY----TIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETL 332
            :::    ::||.     :|:...:|            .|...|||::.:  |::    :|.:...
  Fly   230 ALFKEISSVVTS-----LQDIFNVH------------LFLSALLTLLQV--LVV----WYKMIID 271

  Fly   333 LGKSKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKE 397
            ||       |......:|....:|..|:.:::|.|.:|:..:..|:...|.  |:.|:|......
  Fly   272 LG-------FSDFRIWSFSLKNLIQTLLPVLAIQEAANQFKQTRERALDIF--LVGKSKHWMKSV 327

  Fly   398 KLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQ 442
            ::....:.|...::|.  .||||:...|:..|..|:..||:.:.|
  Fly   328 EIFVTHLNLSEFRVNL--LGLFNVSNELFLIIVSAMFCYLVFVTQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 49/240 (20%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 49/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.