DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr22f

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:457 Identity:96/457 - (21%)
Similarity:164/457 - (35%) Gaps:136/457 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RRFVTAKQLYECLRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGYINGIMH-IAMFVFAYSL 96
            ||..:....:..|:...:.:::.||..|......|..|::....::|:   ::| :||       
  Fly     7 RRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGF---VLHSLAM------- 61

  Fly    97 TIYNNCESVASYF-FRSRITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQT 160
                 |.:::|:. .:.|..|                   .||..|..||:...:|     |:.|
  Fly    62 -----CLAMSSHLASKQRRKY-------------------NAFERNPLLEKIYMQF-----QVTT 97

  Fly   161 VGVKIMYSKVLRFSYMVLISM---------FLVNVLFT-GGTFSVLYSSEVAPTMALHFTFLIQH 215
            .           |:..||:.|         .:.|.|.| .|....|.:.:..|...   .|:|:.
  Fly    98 F-----------FTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFN---CFVIKK 148

  Fly   216 TVIAI---AIALFSCFTYLVEMRLVMVN---KVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMY 274
            .|.||   .|:::.|        |...|   |:||.|.                   ||.|..:.
  Fly   149 HVAAIGQFVISIYFC--------LCQENSYPKILKILC-------------------CLPSVGLQ 186

  Fly   275 TIVTKDPAEII---------QESME-IHHLICEAA-ATANKYFTYQLLTIISIAF----LIIVFD 324
            .|:.....|||         .|::| .|||..... |.|:.|.....|:.:.:|.    ||::..
  Fly   187 LIIMHFHTEIILVYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQLILMLI 251

  Fly   325 AYYVLET-------LLGKSKRESKFKTVEFVTFFSCQMIL-----YLIAIISIVEGSNRAIKKSE 377
            .|.:..|       :||.|..:.....|.     |.|:|:     :|..::..:.|     |..:
  Fly   252 IYLIGNTVQIFFLIVLGVSMNKRYIYLVA-----SPQLIINFWDFWLNIVVCDLAG-----KCGD 306

  Fly   378 KTGGIVHSLLN-KTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILL 441
            :|..::....: :....|::..|.:|:....|.|..|...|||:|:..:.|.:......||:.||
  Fly   307 QTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLL 371

  Fly   442 QF 443
            ||
  Fly   372 QF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 92/443 (21%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 94/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.