DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28b and Gr39b

DIOPT Version :9

Sequence 1:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:393 Identity:87/393 - (22%)
Similarity:150/393 - (38%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VFAYSLTIYNNCESVASYFFRSRITYFGDLMQIVSGFIG----VTVIYLTAFVPNHRLERCLQKF 151
            |::..|.|.|......|.:|......|..||..|..|:.    ||||.|...|......|..::.
  Fly    33 VYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFVARIVCVTVIILQVMVHYDDYFRFCREM 97

  Fly   152 HTMDVQLQTVGVKIMYSKVLRFSYMVLISM---FLVNVL---FTGGTFSVLYS-SEVAPTMALHF 209
            ..:.::|| ..:||...::...||..::::   |||.||   :...:.|:||. |.:...:.:..
  Fly    98 KYLGLRLQ-CELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRM 161

  Fly   210 TF--------LIQHTVIAIAIALFSCFTYLVEMRLVMVNKVLKNLAHQ-WDTRSLKAVNQKQRSL 265
            .|        |:.|.|..:.|.|.:    ::|..|:..|..|...|:: .....|.|:.|....|
  Fly   162 QFVLVLLNVELLGHHVSLLGIRLQN----VLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQL 222

  Fly   266 QCL-----DSFSMYTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDA 325
            ..|     |.|....:.|              :::..:.:|.|.|:|.|:        |:.|::.
  Fly   223 HYLFTHFNDLFGWSILGT--------------YVVLFSDSTVNIYWTQQV--------LVEVYEY 265

  Fly   326 YYVLETLLGKSKRESKFKTVEFVTFFS----------CQMILYLIAIISIVEGSNRAIKKSEKTG 380
            .|:..|.           :|...:||:          ||                   ::|...|
  Fly   266 KYLYATF-----------SVFVPSFFNILVFCRCGEFCQ-------------------RQSVLIG 300

  Fly   381 GIVHSLL---NKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQ 442
            ..:.:|.   :..:....|:.|.:|.:|:....:...|.|..:.|.:|..:|..|..||||:|:|
  Fly   301 SYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQ 365

  Fly   443 FTS 445
            |:|
  Fly   366 FSS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 84/389 (22%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 85/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.